GABBR1 (Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA-B Receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1)

Size

£685.00

SKU:: 127082
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa52-151 from human GABBR1 wiith GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: GABA(B) receptor 1, a GABA(B) Receptor, forms a heterodimer with GABA(B) receptor 2 to mediate the effects of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the central nervous system. Activation of this receptor leads to fast synaptic inhibition. Reduced GABA(B) receptor 1a-b expression is implicated in the pathophysiology of temporal-lobe epilepsy. In primates, GABA(B) receptors are widely distributed and are located to subserve both pre- and postsynaptic roles in controlling synaptic transmission in the primate basal ganglia. Five alternatively spliced protein isoforms of GABA(B) receptor 1 have been identified. GABA(B) receptor 1 is widely expressed, with highest levels reported in brain, and lower levels in gastrointestinal tract, kidney, and uterus. ESTs have been isolated from a wide variety of tissues, including adrenal, brain, breast, colon, embryo, eye, ganglion, head/neck, heart, heart/melanocyte/uterus, liver/spleen, lung, nerve, placenta, prostate, stomach, testis, and tonsil libraries, among others. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice