127082-HRP
GABBR1 (Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA-B Receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1) (HRP)
Size
£914.00
- SKU:
- 127082-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa52-151 from human GABBR1 wiith GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Extra Details:
- GABA(B) receptor 1, a GABA(B) Receptor, forms a heterodimer with GABA(B) receptor 2 to mediate the effects of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the central nervous system. Activation of this receptor leads to fast synaptic inhibition. Reduced GABA(B) receptor 1a-b expression is implicated in the pathophysiology of temporal-lobe epilepsy. In primates, GABA(B) receptors are widely distributed and are located to subserve both pre- and postsynaptic roles in controlling synaptic transmission in the primate basal ganglia. Five alternatively spliced protein isoforms of GABA(B) receptor 1 have been identified. GABA(B) receptor 1 is widely expressed, with highest levels reported in brain, and lower levels in gastrointestinal tract, kidney, and uterus. ESTs have been isolated from a wide variety of tissues, including adrenal, brain, breast, colon, embryo, eye, ganglion, head/neck, heart, heart/melanocyte/uterus, liver/spleen, lung, nerve, placenta, prostate, stomach, testis, and tonsil libraries, among others. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice