127082-BIOTIN

GABBR1 (Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA-B Receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1) (Biotin)

Size

£914.00

SKU:: 127082-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa52-151 from human GABBR1 wiith GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: GABA(B) receptor 1, a GABA(B) Receptor, forms a heterodimer with GABA(B) receptor 2 to mediate the effects of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the central nervous system. Activation of this receptor leads to fast synaptic inhibition. Reduced GABA(B) receptor 1a-b expression is implicated in the pathophysiology of temporal-lobe epilepsy. In primates, GABA(B) receptors are widely distributed and are located to subserve both pre- and postsynaptic roles in controlling synaptic transmission in the primate basal ganglia. Five alternatively spliced protein isoforms of GABA(B) receptor 1 have been identified. GABA(B) receptor 1 is widely expressed, with highest levels reported in brain, and lower levels in gastrointestinal tract, kidney, and uterus. ESTs have been isolated from a wide variety of tissues, including adrenal, brain, breast, colon, embryo, eye, ganglion, head/neck, heart, heart/melanocyte/uterus, liver/spleen, lung, nerve, placenta, prostate, stomach, testis, and tonsil libraries, among others. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice