BUD31 (Protein BUD31 homolog, Protein EDG-2, Protein G10 Homolog, EDG2, EDG-2, fSAP17, G10, MGC111202, YCR063W)

Size

£685.00

SKU:: 127069
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa35-144 from human G10 (NP_003901) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: BUD31, also known as EDG2, is the homolog of BUD31 from Saccharomyces cerevisiae. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.