G-Protein Coupled Receptor 48 (G-protein Coupled Receptor 48, GPR48, Leucine-rich Repeat Containing G-Protein-coupled Receptor 4, LGR4)

Size

£685.00

SKU:: 127056
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa302-360 from human LGR4 (NP_060960) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GPR48 is an Orphan-A GPCR with an unknown ligand. GPR48 expression has been documented in human brain, adrenal, heart, kidney, liver, skeletal muscle, ovary, pancreas, placenta, prostate, spleen, stomach, testis, thyroid, and spinal cord. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.