127054-PE

G-Protein Coupled Receptor 161 (G-Protein-coupled Receptor 161, G-protein Coupled Receptor 161, GPR161, G-protein Coupled Receptor RE2, FLJ33952, RE2) (PE)

Size

£914.00

SKU:: 127054-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa362-461 from GPR161 (NP_722561) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: GPR161/RE2 is an Orphan-U GPCR with an unknown ligand. RE2 is a member of the rhodopsin family of G protein-coupled receptors and may aid in the regulation of aggression and appetite. ESTs have been identified in brain, colon, heart/melanocyte/uterus, lung, prostate, and uterus libraries. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.