FVT1 (Follicular Variant Translocation Protein 1, FVT-1, 3-dehydrosphinganine Reductase, DHSR, 3-ketodihydrosphingosine Reductase, KDS Reductase, KDSR, FLJ36555, FLJ92680, SDR35C1)

Size

£685.00

SKU:: 127029
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-332 from human FVT1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B2-3C11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: FVT1 catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving its gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice