127014
Fucosyltransferase 10 alpha (1,3) (FUT10, FUC-TX, Alpha-(1,3)-fucosyltransferase 10, Galactoside 3-L-fucosyltransferase 10, FucT-X, MGC11141)
Size
£685.00
- SKU:
- 127014
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-93 from human FUT10 (AAH04884) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4H3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Fucosyltransferase 10 is a probable fucosyltransferase that localises to the golgi apparatus, the Golgi stack membrane. It is a single-pass type II membrane protein. There are 7 named isoforms produced by alternative splicing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice