127010-PE
FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (PE)
Size
£914.00
- SKU:
- 127010-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa368-466 from human FUCA2 (NP_114409) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Alpha-L-fucosidase catalyzes the hydrolysis of terminal alpha-L-fucosidase linkages in glycosphingolipids and glycoproteins. At least 2 separate polymorphic alpha-L-fucosidases are recognized in man. The FUCA2 locus regulates the level of alpha-fucosidase in plasma and fibroblasts but not in leukocytes. In fucosidosis, deficiency of alpha-L-fucosidase is found in both plasma and leukocytes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice