FST (Follistatin, FS, Activin-binding Protein)

Size

£698.00

SKU:: 126996
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-344 from human FST with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G4
Format:: Supplied as a liquid.
Extra Details:: Follistatin (FS) was initially identified as a follicle-stimulating hormone inhibiting substance found in ovarian follicular fluid. It has since been shown that FS is a high-affinity activin-binding protein that can act as an activin antagonist. Two alternatively spliced follistatin mRNAs, encoding mature FS with 288aa residues (FS-288) and 315aa residues (FS-315), exist. Natural FS purified from porcine ovaries is primarily a carboxy-terminal truncated form of FS-315 composed of 300aa residues. FS-288 binds with high-affinity to cell-surface heparan sulfate proteoglycans whereas FS-315 binds with low-affinity. Cell surface-associated FS has been suggested to play a role in the clearance and bioavailability of activin in vivo. Besides activin, FS has also been shown to bind with multiple BMPs and to inhibit BMP activity in early Xenopus embryos. FS deficient mice have been shown to have multiple embryonic defects that will result in death shortly after birth. Overexpression of FS can also cause reproductive defects in transgenic mice. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice