FRAP1 (Serine/Threonine-protein Kinase mTOR, Mechanistic Target Of Rapamycin, FK506-binding Protein 12-rapamycin Complex-associated Protein 1, FKBP12-rapamycin Complex-associated Protein, Rapamycin Target Protein 1, RAPT1, Mammalian Target Of Rapamycin, mTOR, FRAP, FRAP2)

Size

£685.00

SKU:: 126975
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1521-1620 from human FRAP1 (NP_004949) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FRAP1 belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. FRAP1 is a part of the TORC2 complex which plays a critical role in AKT1 Ser-473 phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.