126959-APC
FOXP2 (Forkhead Box Protein P2, CAG Repeat Protein 44, Trinucleotide Repeat-containing Gene 10 Protein, CAGH44, TNRC10, DKFZp686H1726, SPCH1) (APC)
Size
£927.00
- SKU:
- 126959-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa616-716 from human FOXP2 (NP_055306) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F8
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Forkhead box protein P2 (FoxP2) is a multidomain transcriptional repressor that belongs to the Fox family of proteins. The FoxP2 protein contains a forkhead-box DNA-binding domain, characteristic of the FOX group of transcription factors. In addition, this protein contains a polyglutamine tract, as well as zinc finger and leucine zipper motifs. In order for FoxP2 to bind DNA, it forms homodimers and heterodimers with FoxP1 and FoxP4. The forkhead box family of proteins play an important role in immune response, organ development and the development of cancer. Functional studies in vertebrates suggest this with this gene plays a role in the modulation neural plasticity. In line with these findings, mutations of FoxP2 in humans have been linked to speech and language disorders. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice