FOXP1 (Forkhead Box Protein P1, HSPC215, 12CC4, FLJ23741, hFKH1B, HSPC215, MGC12942, MGC88572, MGC99551, QRF1)

Size

£685.00

SKU:: 126958
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-115 from human FOXP1 (AAH05055) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E3-G11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FOXP1, an 85kD member of the winged helix/forkhead transcription factor family. The FOXP1 transcription factor is widely expressed in human tissues and is predominantly localised to the nucleus. However, the level of expression does vary between cells and between different tissues. The expression of FOXP1 is reported to be abnormal in a range of solid tumors. Studies suggest that FOXP1 functions as a transcriptional repressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.