126958-ML490

FOXP1 (Forkhead Box Protein P1, HSPC215, 12CC4, FLJ23741, hFKH1B, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (MaxLight 490)

Size

£914.00

SKU:: 126958-ML490
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-115 from human FOXP1 (AAH05055) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E3-G11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Extra Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. FOXP1, an 85kD member of the winged helix/forkhead transcription factor family. The FOXP1 transcription factor is widely expressed in human tissues and is predominantly localised to the nucleus. However, the level of expression does vary between cells and between different tissues. The expression of FOXP1 is reported to be abnormal in a range of solid tumors. Studies suggest that FOXP1 functions as a transcriptional repressor. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice