126957-PE

FOXO3A (Forkhead Box O3A, Forkhead in Rhabdomyosarcoma-like 1, AF6q21 Protein, DKFZp781A0677, FKHR2, FKHRL1, FKHRL1P2, MGC12739, MGC31925) (PE)

Size

£914.00

SKU:: 126957-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa361-460 from human FOXO3A (AAH21224) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Forkhead box O3A (FOXO3A) is a member of the forkhead family of transcription factors (FOXO), which play an important role in cellular proliferation, metabolism, stress tolerance, and aging. FOXO transcription factors have a characteristic forkhead domain and are located in the cytoplasm. Upon oxidative stress, FOXO3A translocates to the nucleus where binding to the DNA sequence 5'-[AG]TAAA[TC]A-3' occurs and IGF-1 is dephosphlorated, resulting in apoptosis. In order for the cell to survive, IGF-1 must be phosphlorated by AKT1/PKB at Thr32 and Ser-253, which will result in retention and inactivation of FOXO3A in the cytoplasm. Translocation of FOXO3A with the MLL gene has been associated with secondary acute leukemia. Applications: Suitable for use in Immunofluorescence, FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice