126951-BIOTIN

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (Biotin)

Size

£914.00

SKU:: 126951-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa341-421 from human FOXJ1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: May play an important role in cell fate determination during lung development and in spermatogenesis. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.