FOXF1 (Forkhead Box Protein F1, Forkhead-related Activator 1, FREAC-1, Forkhead-related Protein FKHL5, Forkhead-related Transcription Factor 1, FKHL5, FREAC1)

Size

£685.00

SKU:: 126944
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa251-353 from human FOXF1 (NP_001442) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.