126940-BIOTIN
FOXC1 (Forkhead Box Protein C1, Forkhead-related Protein FKHL7, Forkhead-related Transcription Factor 3, FREAC-3, FKHL7, FREAC3) (Biotin)
Size
£914.00
- SKU:
- 126940-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa464-553 from human FOXC1 (NP_001444) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- FOXC1, otherwise known as Forkhead box C1, a member of the Forkhead family of transcription factors, shown to be involved in the development of the eye. Studies have shown that FOXC1 plays an important role in the regulation of the FGF19-FGFR4-MAPK pathway involved in the maintenance of anterior segment structures within the eye. Studies have also shown that FOXC1 is essential for the aggressive phenotype of basal-like triple-negative breast cancer (TNBC), for which FOXC1 may prove to be a valuable diagnostic marker. Mutations in the FOXC1 gene are responsible for various ocular abnormalities including Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis anomaly (IGDA), and Peters anomaly. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice