FOXA3 (Hepatocyte Nuclear Factor 3-gamma, HNF-3-gamma, HNF-3G, Forkhead Box Protein A3, Fork Head-related Protein FKH H3, TCF3G, HNF3G, MGC10179)

Size

£685.00

SKU:: 126939
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa266-350 from human FOXA3 (NP_004488.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FOXA3 is a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.