FOXA2 (Hepatocyte Nuclear Factor 3-beta, HNF-3-beta, HNF-3B, Forkhead Box Protein A2, Transcription Factor 3B, TCF-3B, HNF3B, TCF3B), MGC19807)

Size

£685.00

SKU:: 126936
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The transcription factor Foxa2 (also called hepatocyte nuclear factor 3beta, [HNF-3beta) is implicated in blood glucose homeostasis. Overexpression of Foxa2 decrease heptocyte glycogen levels and reduce expression of glucoe homeostasis genes. The loss of Foxa2 function leads to up-regulation of hexokinase (HK) I and II and glucokinase (HK-IV) mRNA expression. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.