126934-HRP

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (HRP)

Size

£914.00

SKU:: 126934-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa367-472 from human FOXA1 (NP_004487) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: FOXA1 (HNF3A, Hepatocyte nuclear factor 3- alpha) is member of the Forkhead family of winged-helix transcription factors. It is known to be involved in the development and differentiation of several organs including liver, kidney, pancreas, lung, prostate and mammary gland (Lupien, 2008). High expression of FOXA1 is often seen in tumors arising from both the prostate and breast where it is believed to interact with either the androgen receptor or estrogen receptor alpha, in each of the tumor type respectively (Lupien, 2008). In the case of ERa, FOXA1 has gained notice because of its interactions with the cis- regulatory regions in heterochromatin and because it enhances the interaction of ERa with chromatin (Badve, 2007). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice