Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP)

Size

£685.00

SKU:: 126926
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa163-205 from human FPRL1 (AAH29125) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FPRL1 is a low affinity receptor to N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). FPRL1 has been reported in phagocytes, monocytes, neutrophils, differentiated myeloid cells from bone marrow, granulocyte HL-60 cells, and synovial fibroblasts. ESTs have been isolated from blood, leukocyte, lung, and placenta libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice