126926-ML650
Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP) (MaxLight 650)
Size
£914.00
- SKU:
- 126926-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa163-205 from human FPRL1 (AAH29125) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. FPRL1 is a low affinity receptor to N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). FPRL1 has been reported in phagocytes, monocytes, neutrophils, differentiated myeloid cells from bone marrow, granulocyte HL-60 cells, and synovial fibroblasts. ESTs have been isolated from blood, leukocyte, lung, and placenta libraries. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice