126926-FITC

Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP) (FITC)

Size

£914.00

SKU:: 126926-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa163-205 from human FPRL1 (AAH29125) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: FPRL1 is a low affinity receptor to N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). FPRL1 has been reported in phagocytes, monocytes, neutrophils, differentiated myeloid cells from bone marrow, granulocyte HL-60 cells, and synovial fibroblasts. ESTs have been isolated from blood, leukocyte, lung, and placenta libraries. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice