FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR) (APC)

Size

£934.00

SKU:: 126924-APC
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human FOLR1, aa1-257 (NP_000793.1).
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Folate receptor 1 (FOLR1; also folate receptor alpha, folate binding protein 1, and MOv18) is a 37-42kD member of the folate receptor family. FOLR1 is expressed in reticulocytes and placenta, plus renal, mammary, and thymic epithelium, where it mediates the transport of 5-methyltetrahydrofolate into the cell. The human FOLR1 preproprecursor is 257aa in length. It codes for a GPI-linked glycoprotein that is 210aa in size (aa25-234). There are two forms of FOLR1. One is GPI-linked, while the other is a soluble MMP cleavage product (aa25-226). There is one potential alternate splice form that shows a five aa substitution for aa121-205. Over aa25-233, human FOLR1 shares 83% aa identity with mouse FOLR1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice