FNDC4 (FRCP1, Fibronectin Type III Domain-containing Protein 4, Fibronectin Type III Repeat-containing Protein 1, FLJ22362, UNQ6389/PRO21134)

Size

£760.00

SKU:: 126921
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human FNDC4, aa1-234 (NP_073734.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FNDC4 contains a fibronectin type-III (FN3) domain. FN3 repeats have been found in various protein families including extracellular-matrix molecules, cell-surface receptors, enzymes, and muscle proteins. The function of FNDC4 is unknown. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.