FMNL2 (Formin-like Protein 2, Formin Homology 2 Domain-containing Protein 2, FHOD2, FLJ37546, KIAA1902)

Size

£685.00

SKU:: 126904
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-179 from human FMNL2 (AAH36492) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Formin-like protein 2 is a cytoplasmic phosphoprotein belonging to the formin homology domain containing protein family and has a DAD (diaphanous autoregulatory domain), FH2 (formin homology 2) domain, and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. The exact function of FMNL2 is yet to be known but reports suggest that it may have a role in the Wnt signaling pathway. Formin-related proteins are also known to play an important role in morphogenesis, cytokinesis and cell polarity. Several alternatively spliced transcript variants have been described but their full-length nature is not yet determined. It is also known to be associated with a diffuse-type gastric cancer, breast cancer, chondrosarcoma, melanoma, and glioblastoma. FMNL2 might be implicated in polarity control, invasion, migration or metastasis through actin filament nucleation and may be regulated by Rho family GTPase. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice