126904-APC
FMNL2 (Formin-like Protein 2, Formin Homology 2 Domain-containing Protein 2, FHOD2, FLJ37546, KIAA1902) (APC)
Size
£927.00
- SKU:
- 126904-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-179 from human FMNL2 (AAH36492) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Formin-like protein 2 is a cytoplasmic phosphoprotein belonging to the formin homology domain containing protein family and has a DAD (diaphanous autoregulatory domain), FH2 (formin homology 2) domain, and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. The exact function of FMNL2 is yet to be known but reports suggest that it may have a role in the Wnt signaling pathway. Formin-related proteins are also known to play an important role in morphogenesis, cytokinesis and cell polarity. Several alternatively spliced transcript variants have been described but their full-length nature is not yet determined. It is also known to be associated with a diffuse-type gastric cancer, breast cancer, chondrosarcoma, melanoma, and glioblastoma. FMNL2 might be implicated in polarity control, invasion, migration or metastasis through actin filament nucleation and may be regulated by Rho family GTPase. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice