FMN2 (Formin 2, Formin-2)

Size

£685.00

SKU:: 126902
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa144-243 from human FMN2 (AAH14364) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FMN2, a novel formin homology protein of the cappuccino subfamily, is highly conserved between evolutionarily diverse vertebrates. FMN2 bears a high degree of similarity to formin-1 which is the founding member of formin homology proteins. FMN2 plays a crucial role in maintenance of the meiotic spindle. The protein is widely expressed in human fetal brain, adult whole brain, hypothalamus, retina, pancreatic islet and germinal-center B cells. Pathological role of the protein is identified in various tumors like parathyloid tumor, glioblastoma, retinoblastoma and chondrosarcoma. FMN2 mutations are often a cause of unexplained infertility in women. The gene encoding for human FMN2 is localized in the chromosomal region 1q43. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice