126902-ML650
FMN2 (Formin 2, Formin-2) (MaxLight 650)
Size
£914.00
- SKU:
- 126902-ML650
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa144-243 from human FMN2 (AAH14364) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. FMN2, a novel formin homology protein of the cappuccino subfamily, is highly conserved between evolutionarily diverse vertebrates. FMN2 bears a high degree of similarity to formin-1 which is the founding member of formin homology proteins. FMN2 plays a crucial role in maintenance of the meiotic spindle. The protein is widely expressed in human fetal brain, adult whole brain, hypothalamus, retina, pancreatic islet and germinal-center B cells. Pathological role of the protein is identified in various tumors like parathyloid tumor, glioblastoma, retinoblastoma and chondrosarcoma. FMN2 mutations are often a cause of unexplained infertility in women. The gene encoding for human FMN2 is localized in the chromosomal region 1q43. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice