126902-BIOTIN
FMN2 (Formin 2, Formin-2) (Biotin)
Size
£914.00
- SKU:
- 126902-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa144-243 from human FMN2 (AAH14364) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- FMN2, a novel formin homology protein of the cappuccino subfamily, is highly conserved between evolutionarily diverse vertebrates. FMN2 bears a high degree of similarity to formin-1 which is the founding member of formin homology proteins. FMN2 plays a crucial role in maintenance of the meiotic spindle. The protein is widely expressed in human fetal brain, adult whole brain, hypothalamus, retina, pancreatic islet and germinal-center B cells. Pathological role of the protein is identified in various tumors like parathyloid tumor, glioblastoma, retinoblastoma and chondrosarcoma. FMN2 mutations are often a cause of unexplained infertility in women. The gene encoding for human FMN2 is localized in the chromosomal region 1q43. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice