126897-BIOTIN
Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (Biotin)
Size
£914.00
- SKU:
- 126897-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa27-136 from human FLT3LG (NP_001450) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Flt3L exists in both a membrane-bound and proteolytically cleaved soluble isoform, both of which are biologically active, and initiates cell proliferation/ differentiation signalling in co-operation with other colony stimulating factors (CSFs) and interleukins, by binding to and activating the tyrosine kinase receptor Flt3 (FLT3R), expressed highly by hematopoietic progenitor cells and stem cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice