CDHR3 (Cadherin-related Family Member 3, Cadherin-like Protein 28, CDH28, FLJ23834, FLJ43271, FLJ44366, MGC133292, MGC133293)

Size

£685.00

SKU:: 126869
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa776-885 from human CDHR3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8E8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.