126841-BIOTIN
FKHR (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (Biotin)
Size
£914.00
- SKU:
- 126841-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa556-655 from human FOXO1A (NP_002006) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- FKHR gene was first identified by virtue of its fusion to the PAX3 gene in the t(2;13) translocation found in the pediatric soft tissue tumor alveolar rhabdomyosarcoma . FKHR gene encodes for a protein containing a DNA-binding motif shared with members of the HNF-3:forkhead family of transcription factors. The protein acts as a potential Akt nuclear target in metabolic and survival pathways. The protein may also play a role in myogenic growth and differentiation. Human FKHR gene is usually localized in the chromosomal region 13q14.1. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice