FKBP14 (FK506-binding Protein 14, Peptidyl-prolyl Cis-trans Isomerase FKBP14, PPIase FKBP14, Rotamase, 22kD FK506-binding Protein, 22kD FKBP, FKBP-2, FKBP-22, FLJ20731, FKBP22, FKBP-14, UNQ322/PRO381)

Size

£685.00

SKU:: 126828
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human FKBP14, aa1-211 (NP_060416.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FKBP14, also known as 22kD FK506-binding protein, is an enzyme that accelerates the folding of proteins during protein synthesis. This protein contains two EF-hand domains and one PPIase FKBP-type domain. Truncation of the amino-terminus of FKBP14 greatly reduces peptidyl prolyl cis-trans isomerase activity, therefore suggesting that the PPIase FKBP-type domain must be located at the N-terminus. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.