126821-BIOTIN
Filensin (Beaded Filament Structural Protein 1, BFSP1, Lens Fiber Cell Beaded-filament Structural Protein CP 115, CP115, Lens Intermediate Filament-like Heavy, LIFL-H) (Biotin)
Size
£914.00
- SKU:
- 126821-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa567-664 from human BFSP1 (NP_001186) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Filensin, also known as beaded filament structure protein 1, have two major component BFSP1 and BESP2. Filensin gene is mapped at 20p12.1-p11.23. The sequence of the predicted 665aa human protein is 62% and 50% identical to those of bovine and chicken filensin, respectively. However,it has less than 26% identity to other members of the intermediate filament (IF) family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice