126817-BIOTIN

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (Biotin)

Size

£914.00

SKU:: 126817-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.