126817-APC

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (APC)

Size

£927.00

SKU:: 126817-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.