126806-HRP
FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B) (HRP)
Size
£914.00
- SKU:
- 126806-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa31-130 from human FHIT (AAH32336) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- FHIT is a putative human tumor suppressor gene at chromosome 3p14.2 that was identified recently by positional cloning. Homozygous deletions within the FHIT locus have been observed in cell lines derived from cancers of the esophagus, stomach, colon, breast, kidney, and lung, and aberrant transcripts were observed in several types of primary tumors. This gene also encompasses the site of the t (3; 8) translocation breakpoint of familial renal clear cell carcinoma and the fragile site locus FRA3B. The1.1-kb FHIT cDNA is encoded by 10 small exons distributed over a genomic locus of about 1 Mb; the t (3;8) break falls between untranslated 5' exons 3 and 4. The protein is a dinucleoside 5', 5'''-P1, P3-triphosphate hydrolase and the histidine residues of the HIT sequence are critical for the Ap3A hydrolase activity of Fhit. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice