FGD3 (ZFYVE5, FYVE, RhoGEF and PH Domain-containing Protein 3, Zinc Finger FYVE Domain-containing Protein 5, FLJ00004, MGC117260)

Size

£685.00

SKU:: 126759
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa83-174 from human FGD3 (NP_149077) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Promotes the formation of filopodia. May activate CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Plays a role in regulating the actin cytoskeleton and cell shape. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKVTPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.