FBXW12 (FBW12, FBXO12, FBXO35, F-box/WD Repeat-containing Protein 12, F-box and WD-40 Domain-containing Protein 12, F-box Only Protein 35, MGC120385, MGC120386, MGC120387)

Size

£685.00

SKU:: 126713
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa265-355 from human FBXW12 (NP_996985) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.