FBXO11 (FBX11, VIT1, F-box Only Protein 11, Vitiligo-associated Protein 1, VIT-1, FLJ12673, MGC44383, PRMT9, UBR6, UG063H01)

Size

£685.00

SKU:: 126671
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa744-844 from human FBXO11 (NP_079409) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.