FBXL21 (F-box/LRR-repeat Protein 21, F-box and Leucine-rich repeat Protein 21, F-box and Leucine-rich Repeat Protein 3B, F-box/LRR-repeat Protein 3B, FBL21, FBL3, FBXL3B, FBXL3P)

Size

£685.00

SKU:: 126660
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa167-277 from human FBXL21 (NP_036291) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex involved in circadian pacemaker function. The SCF(FBXL21) complex acts by mediating ubiquitination and subsequent degradation of CRY1. Probable clock-controlled protein that plays a specific role in suprachiasmatic nucleus, SCN and pacemaker function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.