FARP1 (FERM, RhoGEF and Pleckstrin Domain-containing Protein 1, Chondrocyte-derived Ezrin-like Protein, Pleckstrin Homology Domain-containing Family C Member 2, PH Domain-containing Family C Member 2, CDEP, PLEKHC2)

Size

£685.00

SKU:: 126627
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa471-549 from FARP1 (NP_005757) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Applications: Suitable for use in Western Blot, Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.