FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517)

Size

£685.00

SKU:: 126611
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-292 from human FAM84A (AAH26346) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: FAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.