FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473)

Size

£685.00

SKU:: 126582
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human FAM107A, aa1-144 (NP_009108.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeuence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.