FAIM2 (KIAA0950, LFG, LFG2, NMP35, TMBIM2, Protein Lifeguard 2, Fas Apoptotic Inhibitory Molecule 2, Neural Membrane Protein 35, Transmembrane BAX Inhibitor Motif-containing Protein 2)

Size

£685.00

SKU:: 126578
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-317 from FAIM2 (AAH00051) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: FAIM2 protects cells uniquely from Fas-induced apoptosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.