EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591)

Size

£685.00

SKU:: 126526
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa309-407 from human EYS with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F2
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Required to maintain the integrity of photoreceptor cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.