126526-HRP

EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (HRP)

Size

£914.00

SKU:: 126526-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa309-407 from human EYS with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F2
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Horseradish peroxidase (HRP).
Extra Details:: Required to maintain the integrity of photoreceptor cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.