EXOSC7 (Exosome Complex Exonuclease RRP42, Ribosomal RNA-processing Protein 42, Exosome Component 7, p8, KIAA0116, RRP42, FLJ26543, hRrp42p)

Size

£685.00

SKU:: 126516
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa192-292 fromEXOSC7 (NP_055819) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: EXOSC7 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and has a 3'-5' exonuclease activity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVLHKEESLGPKRQKVGFLG* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.